PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000776583
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 62aa    MW: 6951.99 Da    PI: 4.6016
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000776583genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM51.34e-161057149
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                   lppGfrF P+deelv++yL kk+++++     ++ e+d++ +ePw+Lp 
  MDP0000776583 10 LPPGFRFYPSDEELVCHYLYKKITNEEALK-GTLVEIDLHICEPWQLPG 57
                   79***********************99544.78**************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-17859IPR003441NAC domain
PROSITE profilePS5100519.3261061IPR003441NAC domain
PfamPF023659.8E-91153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLYK KITNEEALKG TLVEIDLHIC EPWQLPGTFA  60
N*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981221e-75KF198122.1 Malus hupehensis NAC domain protein (NAC86) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008372572.13e-36PREDICTED: glutathione gamma-glutamylcysteinyltransferase 1-like
SwissprotO040179e-16NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
SwissprotQ9FFI51e-15NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0A0KA397e-36A0A0A0KA39_CUCSA; Uncharacterized protein
TrEMBLW9RQU51e-35W9RQU5_9R
STRINGPOPTR_0005s24760.12e-34(Populus trichocarpa)
STRINGGLYMA19G34881.13e-34(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1720277
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.21e-25NAC domain containing protein 74